PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn051601
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 390aa    MW: 44163.2 Da    PI: 4.7284
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn051601genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-16152197148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+e ++++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
       Achn051601 152 RGNFTQQEEETIIKLHQSLGNR-WSKIASSLP-GRTDNEIKNVWNTHL 197
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5005320.544154IPR000626Ubiquitin domain
SMARTSM002131.5E-5150IPR000626Ubiquitin domain
PRINTSPR003482.2E-241030IPR019956Ubiquitin
Gene3DG3DSA:3.10.20.906.5E-271054No hitNo description
SuperFamilySSF542362.43E-181054IPR029071Ubiquitin-related domain
PfamPF002401.2E-171052IPR000626Ubiquitin domain
PRINTSPR003482.2E-243152IPR019956Ubiquitin
PROSITE profilePS5005326.42455130IPR000626Ubiquitin domain
SMARTSM002131.2E-2755126IPR000626Ubiquitin domain
SuperFamilySSF542361.59E-2656130IPR029071Ubiquitin-related domain
CDDcd018061.37E-4356130No hitNo description
Gene3DG3DSA:3.10.20.902.2E-3557130No hitNo description
PfamPF002404.9E-2757128IPR000626Ubiquitin domain
PROSITE patternPS00299081106IPR019954Ubiquitin conserved site
PROSITE profilePS500904.054133146IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.5E-11133159IPR009057Homeodomain-like
SuperFamilySSF466895.7E-21133201IPR009057Homeodomain-like
PROSITE profilePS5129424.194147201IPR017930Myb domain
SMARTSM007177.4E-15151199IPR001005SANT/Myb domain
PfamPF002493.8E-15152197IPR001005SANT/Myb domain
CDDcd001678.76E-10154197No hitNo description
Gene3DG3DSA:1.10.10.601.8E-22160198IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MLAADLVALD KEGIPPDQQR LIFAGKQLED GRTLADYNIQ KESTLHLVLR LRGGTMIKVK  60
TLTGKEIEID IEPTDTIDRI KERVEEKEGI PPVQQRLIYA GKQLGDDKTA KDYNIEGGSV  120
LHLVLALRGG LLRCGKSCRL RWINYLRPDV KRGNFTQQEE ETIIKLHQSL GNRWSKIASS  180
LPGRTDNEIK NVWNTHLKKR TLVNKDANYD KDELTKEFSR NSSSSSTSSF INMEVLEKEE  240
NTLTMETSDE PKEAPSSSSI SSHSSSNCSN NSNQVDQVIE IPWESDIDFW EMLDNLDPFK  300
SNESQPHEQL EVSKSSNLGE ENDHGEIEYR KWLKYLENEL GLEATSDGDK NTTKDADGQL  360
GFEMTLRPEN DYGKCYFQMW PSSPQSFGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3znz_B5e-59101313152POLYUBIQUITIN-C
3b0a_D5e-59101313152Polyubiquitin-C
3b0a_A5e-59101313152Polyubiquitin-C
3b08_J5e-59101313152Polyubiquitin-C
3b08_G5e-59101313152Polyubiquitin-C
3b08_D5e-59101313152Polyubiquitin-C
3b08_A5e-59101313152Polyubiquitin-C
2w9n_A5e-59101313152UBIQUITIN
3axc_A6e-59101311154Ubiquitin
2zvo_G6e-59101311154UBC protein
2zvo_A6e-59101311154UBC protein
2zvn_E6e-59101311154UBC protein
2zvn_C6e-59101311154UBC protein
2zvn_G6e-59101311154UBC protein
2zvn_A6e-59101311154UBC protein
4zqs_B6e-59101314157ubiquitin
4zqs_A6e-59101314157ubiquitin
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.18e-44myb domain protein 58